SCOPe 2.05: Domain d4mlva1: 4mlv A:-1-218

Lineage for d4mlva1 (4mlv A:-1-218)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (120 species)
   not a true protein

7. Species Bacillus megaterium [TaxId:1404] [238213] (2 PDB entries)

8. Domain d4mlva1: 4mlv A:-1-218 [253804]
   Other proteins in same PDB: d4mlva2
   automated match to d4mlqa1
   complexed with 29p, acy, dpm

Details for d4mlva1

PDB Entry: 4mlv, 1.46 Å

PDB Description: Crystal Structure of Bacillus megaterium porphobilinogen deaminase

PDB Compounds: (A:) porphobilinogen deaminase

SCOPe Domain Sequences for d4mlva1:

Sequence, based on SEQRES records:

>d4mlva1 c.94.1.0 (A:-1-218) automated matches {Bacillus megaterium [TaxId: 1404]}
shmrkiivgsrrsklaltqtkwvieqlkkqglpfefeikemvtkgdqilnvtlskvggkg
lfvkeieqamldkeidmavhsmkdmpavlpegltigciplredhrdaliskngerfeelp
sgavigtsslrrgaqllsmrsdieikwirgnidtrleklknedydaiilaaaglsrmgws
kdtvtqylepeisvpavgqgalaiecrendhellsllqal

Sequence, based on observed residues (ATOM records):

>d4mlva1 c.94.1.0 (A:-1-218) automated matches {Bacillus megaterium [TaxId: 1404]}
shmrkiivgsrrsklaltqtkwvieqlkkqglpfefeikemvkeieqamldkeidmavhs
mkdmpavlpegltigciplredhrdaliskngerfeelpsgavigtsslrrgaqllsmrs
dieikwirgnidtrleklknedydaiilaaaglsrmgwskdtvtqylepeisvpavgqga
laiecrendhellsllqal

Timeline for d4mlva1:

• d4mlva1 first appeared in SCOPe 2.04
  
• d4mlva1 appears in SCOPe 2.06
  
• d4mlva1 appears in the current release, SCOPe 2.08