Lineage for d1vqe__ (1vqe -)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.40: OB-fold [50198] (7 superfamilies) Superfamily b.40.4: Nucleic acid-binding proteins [50249] (8 families) 
Family b.40.4.7: Filamentous bacteriophage ssDNA-binding proteins [50315] (2 proteins) Protein Gene V protein [50316] (2 species) Species Filamentous bacteriophage (f1, M13) [50317] (19 PDB entries) 
Domain d1vqe__: 1vqe - [25380]
Details for d1vqe__
PDB Entry: 1vqe (more details), 1.8 Å
PDB Description: gene v protein mutant with val 35 replaced by ile 35 and ile 47 replaced by met 47 (v35i, i47m)
SCOP Domain Sequences for d1vqe__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vqe__ b.40.4.7 (-) Gene V protein {Filamentous bacteriophage (f1, M13)}
mikveikpsqaqfttrsgvsrqgkpyslneqlcyidlgneypvlvkmtldegqpayapgl
ytvhlssfkvgqfgslmidrlrlvpa
SCOP Domain Coordinates for d1vqe__:
Click to download the PDB-style file with coordinates for d1vqe__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1vqe__:
- d1vqe__ appears in SCOP 1.57
- d1vqe__ appears in the current release, SCOPe 2.08, called d1vqea_
View in 3D