Lineage for d4md7h_ (4md7 H:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1929110Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1929111Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1929232Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1931173Protein Protein kinase CK2, alpha subunit [56142] (3 species)
    CMGC group; CK2 subfamily; serine/threonine kinase
  7. 1931174Species Human (Homo sapiens) [TaxId:9606] [75559] (45 PDB entries)
  8. 1931233Domain d4md7h_: 4md7 H: [253795]
    Other proteins in same PDB: d4md7a_, d4md7b_, d4md7c_, d4md7d_
    automated match to d3wara_
    complexed with zn

Details for d4md7h_

PDB Entry: 4md7 (more details), 3.1 Å

PDB Description: Crystal Structure of full-length symmetric CK2 holoenzyme
PDB Compounds: (H:) Casein kinase II subunit alpha

SCOPe Domain Sequences for d4md7h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4md7h_ d.144.1.7 (H:) Protein kinase CK2, alpha subunit {Human (Homo sapiens) [TaxId: 9606]}
pvpsrarvytdvnthrpreywdyeshvvewgnqddyqlvrklgrgkysevfeainitnne
kvvvkilkpvkkkkikreikilenlrggpniitladivkdpvsrtpalvfehvnntdfkq
lyqtltdydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlidwglaefyh
pgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnydqlv
riakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdfldk
llrydhqsrltareamehpyfytvvkdqar

SCOPe Domain Coordinates for d4md7h_:

Click to download the PDB-style file with coordinates for d4md7h_.
(The format of our PDB-style files is described here.)

Timeline for d4md7h_: