Lineage for d4md7b_ (4md7 B:)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1705786Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1705962Superfamily g.41.4: Casein kinase II beta subunit [57798] (1 family) (S)
    automatically mapped to Pfam PF01214
  5. 1705963Family g.41.4.1: Casein kinase II beta subunit [57799] (1 protein)
    contains alpha-helices in the N- and C-terminal extensions (linkers?)
  6. 1705964Protein Casein kinase II beta subunit [57800] (3 species)
  7. 1705974Species Human (Homo sapiens) [TaxId:9606] [57801] (5 PDB entries)
  8. 1705982Domain d4md7b_: 4md7 B: [253789]
    Other proteins in same PDB: d4md7e_, d4md7f_, d4md7g_, d4md7h_
    automated match to d1jwhd_
    complexed with zn

Details for d4md7b_

PDB Entry: 4md7 (more details), 3.1 Å

PDB Description: Crystal Structure of full-length symmetric CK2 holoenzyme
PDB Compounds: (B:) Casein kinase II subunit beta

SCOPe Domain Sequences for d4md7b_:

Sequence, based on SEQRES records: (download)

>d4md7b_ g.41.4.1 (B:) Casein kinase II beta subunit {Human (Homo sapiens) [TaxId: 9606]}
vswiswfcglrgneffcevdedyiqdkfnltglneqvphyrqaldmildlepdeelednp
nqsdlieqaaemlygliharyiltnrgiaqmlekyqqgdfgycprvycenqpmlpiglsd
ipgeamvklycpkcmdvytpkssrhhhtdgayfgtgfphmlfmvhpeyrpkrpanqfvpr
lygfkihpmayqlqlqaasnf

Sequence, based on observed residues (ATOM records): (download)

>d4md7b_ g.41.4.1 (B:) Casein kinase II beta subunit {Human (Homo sapiens) [TaxId: 9606]}
vswiswfcglrgneffcevdedyiqdkfnltglneqvphyrqaldmildlepdpnqsdli
eqaaemlygliharyiltnrgiaqmlekyqqgdfgycprvycenqpmlpiglsdipgeam
vklycpkcmdvytpkssrhhhtdgayfgtgfphmlfmvhpeyrpkrpanqfvprlygfki
hpmayqlqlqaasnf

SCOPe Domain Coordinates for d4md7b_:

Click to download the PDB-style file with coordinates for d4md7b_.
(The format of our PDB-style files is described here.)

Timeline for d4md7b_: