Lineage for d4mctc_ (4mct C:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1488831Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 1488832Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 1488929Family a.35.1.3: SinR domain-like [47432] (9 proteins)
  6. 1488930Protein Antitoxin HigA [158465] (2 species)
    Uncharacterized transcriptional regulator YddM
  7. 1488934Species Proteus vulgaris [TaxId:585] [229675] (2 PDB entries)
  8. 1488939Domain d4mctc_: 4mct C: [253787]
    automated match to d4mcxa_

Details for d4mctc_

PDB Entry: 4mct (more details), 2.8 Å

PDB Description: p. vulgaris higba structure, crystal form 1
PDB Compounds: (C:) Antidote protein

SCOPe Domain Sequences for d4mctc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mctc_ a.35.1.3 (C:) Antitoxin HigA {Proteus vulgaris [TaxId: 585]}
mrqfkvshpgemiardledmgvsgrrfahnigvtpatvsrllagktaltpslsiriaaal
gstpefwlrlqsnydlrqlenqidtsgivlyge

SCOPe Domain Coordinates for d4mctc_:

Click to download the PDB-style file with coordinates for d4mctc_.
(The format of our PDB-style files is described here.)

Timeline for d4mctc_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4mcta_