SCOPe 2.08: Domain d4mctc_: 4mct C:

Lineage for d4mctc_ (4mct C:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.3: SinR domain-like [47432] (9 proteins)

6. Protein Antitoxin HigA [158465] (2 species)
   Uncharacterized transcriptional regulator YddM

7. Species Proteus vulgaris [TaxId:585] [229675] (3 PDB entries)

8. Domain d4mctc_: 4mct C: [253787]
   automated match to d4mcxa_

Details for d4mctc_

PDB Entry: 4mct, 2.8 Å

PDB Description: p. vulgaris higba structure, crystal form 1

PDB Compounds: (C:) Antidote protein

SCOPe Domain Sequences for d4mctc_:

Sequence; same for both SEQRES and ATOM records:

>d4mctc_ a.35.1.3 (C:) Antitoxin HigA {Proteus vulgaris [TaxId: 585]}
mrqfkvshpgemiardledmgvsgrrfahnigvtpatvsrllagktaltpslsiriaaal
gstpefwlrlqsnydlrqlenqidtsgivlyge

Timeline for d4mctc_:

• d4mctc_ first appeared in SCOPe 2.04
  
• d4mctc_ appears in SCOPe 2.07