| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) ![]() |
| Family a.35.1.3: SinR domain-like [47432] (9 proteins) |
| Protein Antitoxin HigA [158465] (2 species) Uncharacterized transcriptional regulator YddM |
| Species Proteus vulgaris [TaxId:585] [229675] (3 PDB entries) |
| Domain d4mcta_: 4mct A: [253786] automated match to d4mcxa_ |
PDB Entry: 4mct (more details), 2.8 Å
SCOPe Domain Sequences for d4mcta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mcta_ a.35.1.3 (A:) Antitoxin HigA {Proteus vulgaris [TaxId: 585]}
mrqfkvshpgemiardledmgvsgrrfahnigvtpatvsrllagktaltpslsiriaaal
gstpefwlrlqsnydlrqlenqidtsgivlyg
Timeline for d4mcta_: