Lineage for d4mcha_ (4mch A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1608160Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 1608177Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 1608995Family c.56.2.0: automated matches [191488] (1 protein)
    not a true family
  6. 1608996Protein automated matches [190781] (30 species)
    not a true protein
  7. 1609181Species Vibrio fischeri [TaxId:312309] [226714] (4 PDB entries)
  8. 1609183Domain d4mcha_: 4mch A: [253784]
    automated match to d2iscc_
    complexed with 61n, dms, so4

Details for d4mcha_

PDB Entry: 4mch (more details), 1.73 Å

PDB Description: Crystal structure of uridine phosphorylase from vibrio fischeri es114 complexed with 6-hydroxy-1-naphthoic acid, NYSGRC Target 029520.
PDB Compounds: (A:) Uridine phosphorylase

SCOPe Domain Sequences for d4mcha_:

Sequence, based on SEQRES records: (download)

>d4mcha_ c.56.2.0 (A:) automated matches {Vibrio fischeri [TaxId: 312309]}
lyfqsmskqphicvdenqvspyvivcgepdrvnrivelmdnvellaenreyrvfngvykg
ttiticstgigapsmiiaveelklcgathvirvgsagamqdhiqlgelivaegavrdegg
skayissaypayasfallkeishflenqsvkyyfgvvrshdsfytdeedqlcqywnkkgi
lgadmetsalftvgrlrglqvasilnnvvlyqqdvkegvnqyvndnkammngerlaaita
letlckq

Sequence, based on observed residues (ATOM records): (download)

>d4mcha_ c.56.2.0 (A:) automated matches {Vibrio fischeri [TaxId: 312309]}
lyfqsmskqphicvdenqvspyvivcgepdrvnrivelmdnvellaenreyrvfngvykg
ttiticstgigapsmiiaveelklcgathvirvgsagamqdhiqlgelivaegavrdegg
skayissaypayasfallkeishflenqsvkyyfgvvrshdsfytdeedqlcqywnkkgi
lgadmetsalftvgrlrglqvasilnnvvlyqegvnqyvndnkammngerlaaitaletl
ckq

SCOPe Domain Coordinates for d4mcha_:

Click to download the PDB-style file with coordinates for d4mcha_.
(The format of our PDB-style files is described here.)

Timeline for d4mcha_: