Lineage for d4mcda_ (4mcd A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2921212Fold c.116: alpha/beta knot [75216] (1 superfamily)
    core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot
  4. 2921213Superfamily c.116.1: alpha/beta knot [75217] (9 families) (S)
    known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
    all known members have dimeric structures
  5. 2921288Family c.116.1.4: tRNA(m1G37)-methyltransferase TrmD [89629] (2 proteins)
    fold and dimerisation mode are similar to those of the YbeA-like family; contains additional C-terminal all-alpha subdomain
  6. 2921301Protein automated matches [196235] (4 species)
    not a true protein
  7. 2921302Species Haemophilus influenzae [TaxId:71421] [196236] (37 PDB entries)
  8. 2921303Domain d4mcda_: 4mcd A: [253783]
    automated match to d1uaja_
    complexed with 22l

Details for d4mcda_

PDB Entry: 4mcd (more details), 1.55 Å

PDB Description: hintrmd in complex with 5-phenylthieno[2,3-d]pyrimidin-4(3h)-one
PDB Compounds: (A:) tRNA (guanine-N(1)-)-methyltransferase

SCOPe Domain Sequences for d4mcda_:

Sequence, based on SEQRES records: (download)

>d4mcda_ c.116.1.4 (A:) automated matches {Haemophilus influenzae [TaxId: 71421]}
mwigvislfpemfkaitefgvtgravkhnllkvecwnprdftfdkhktvddrpygggpgm
lmmvqplrdaihtakaaagegakviylspqgrkldqggvtelaqnqklilvcgryegide
rliqteideewsigdyvltggelpamtlidavarfipgvlgkqasaeedsfadglldcph
ytrpevlegltvppvlmsghheeirkwrlkqslqrtwlrrpelleglaltdeqrkllkea
qaehns

Sequence, based on observed residues (ATOM records): (download)

>d4mcda_ c.116.1.4 (A:) automated matches {Haemophilus influenzae [TaxId: 71421]}
mwigvislfpemfkaitefgvtgravkhnllkvecwnprdftfdkhktvddrpygggpgm
lmmvqplrdaihtakaaagegakviylspqgrkldqggvtelaqnqklilvcgryegide
rliqteideewsigdyvltggelpamtlidavarfipgvlsfadglldcphytrpevleg
ltvppvlmsghheeirkwrlkqslqrtwlrrpelleglaltdeqrkllkeaqaehns

SCOPe Domain Coordinates for d4mcda_:

Click to download the PDB-style file with coordinates for d4mcda_.
(The format of our PDB-style files is described here.)

Timeline for d4mcda_: