![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
![]() | Protein automated matches [190226] (81 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [186988] (11 PDB entries) |
![]() | Domain d4m9pa3: 4m9p A:670-766 [253782] automated match to d2dica1 |
PDB Entry: 4m9p (more details), 1.72 Å
SCOPe Domain Sequences for d4m9pa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4m9pa3 b.1.18.0 (A:670-766) automated matches {Human (Homo sapiens) [TaxId: 9606]} fhpdrvkargpglektgvavnkpaeftvdakhggkaplrvqvqdnegcpvealvkdngng tyscsyvprkpvkhtamvswggvsipnspfrvnvgag
Timeline for d4m9pa3: