SCOPe 2.06: Domain d4m9pa2: 4m9p A:574-669

Lineage for d4m9pa2 (4m9p A:574-669)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (55 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186988] (10 PDB entries)

8. Domain d4m9pa2: 4m9p A:574-669 [253781]
   automated match to d2dica1

Details for d4m9pa2

PDB Entry: 4m9p, 1.72 Å

PDB Description: Crystal structure of the human filamin A Ig-like domains 3-5

PDB Compounds: (A:) Filamin-A

SCOPe Domain Sequences for d4m9pa2:

Sequence; same for both SEQRES and ATOM records:

>d4m9pa2 b.1.18.0 (A:574-669) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cgnqkvrawgpgleggvvgksadfvveaigddvgtlgfsvegpsqakiecddkgdgscdv
rywpqeageyavhvlcnsedirlspfmadirdapqd

Timeline for d4m9pa2:

• d4m9pa2 first appeared in SCOPe 2.04
  
• d4m9pa2 appears in SCOPe 2.05
  
• d4m9pa2 appears in SCOPe 2.07
  
• d4m9pa2 appears in the current release, SCOPe 2.08