Lineage for d4m9pa2 (4m9p A:574-669)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2766140Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2766141Protein automated matches [190226] (81 species)
    not a true protein
  7. 2766305Species Human (Homo sapiens) [TaxId:9606] [186988] (11 PDB entries)
  8. 2766307Domain d4m9pa2: 4m9p A:574-669 [253781]
    automated match to d2dica1

Details for d4m9pa2

PDB Entry: 4m9p (more details), 1.72 Å

PDB Description: Crystal structure of the human filamin A Ig-like domains 3-5
PDB Compounds: (A:) Filamin-A

SCOPe Domain Sequences for d4m9pa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m9pa2 b.1.18.0 (A:574-669) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cgnqkvrawgpgleggvvgksadfvveaigddvgtlgfsvegpsqakiecddkgdgscdv
rywpqeageyavhvlcnsedirlspfmadirdapqd

SCOPe Domain Coordinates for d4m9pa2:

Click to download the PDB-style file with coordinates for d4m9pa2.
(The format of our PDB-style files is described here.)

Timeline for d4m9pa2: