| Class b: All beta proteins [48724] (177 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
| Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
| Protein automated matches [190226] (55 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [186988] (10 PDB entries) |
| Domain d4m9pa1: 4m9p A:478-573 [253780] automated match to d2dica1 |
PDB Entry: 4m9p (more details), 1.72 Å
SCOPe Domain Sequences for d4m9pa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4m9pa1 b.1.18.0 (A:478-573) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cnpsacravgrglqpkgvrvketadfkvytkgagsgelkvtvkgpkgeervkqkdlgdgv
ygfeyypmvpgtyivtitwggqnigrspfevkvgte
Timeline for d4m9pa1: