Lineage for d4m9pa1 (4m9p A:478-573)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1770169Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1771068Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 1771069Protein automated matches [190226] (43 species)
    not a true protein
  7. 1771182Species Human (Homo sapiens) [TaxId:9606] [186988] (10 PDB entries)
  8. 1771183Domain d4m9pa1: 4m9p A:478-573 [253780]
    automated match to d2dica1

Details for d4m9pa1

PDB Entry: 4m9p (more details), 1.72 Å

PDB Description: Crystal structure of the human filamin A Ig-like domains 3-5
PDB Compounds: (A:) Filamin-A

SCOPe Domain Sequences for d4m9pa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m9pa1 b.1.18.0 (A:478-573) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cnpsacravgrglqpkgvrvketadfkvytkgagsgelkvtvkgpkgeervkqkdlgdgv
ygfeyypmvpgtyivtitwggqnigrspfevkvgte

SCOPe Domain Coordinates for d4m9pa1:

Click to download the PDB-style file with coordinates for d4m9pa1.
(The format of our PDB-style files is described here.)

Timeline for d4m9pa1: