SCOPe 2.08: Domain d4m93c2: 4m93 C:108-213

Lineage for d4m93c2 (4m93 C:108-213)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d4m93c2: 4m93 C:108-213 [253777]
   Other proteins in same PDB: d4m93b_, d4m93c1, d4m93h_, d4m93l1
   automated match to d4ma1l2
   complexed with act, ca, nag

Details for d4m93c2

PDB Entry: 4m93, 2.09 Å

PDB Description: unliganded 2 crystal structure of s25-26 fab

PDB Compounds: (C:) S25-26 Fab (Igg1k) Light Chain

SCOPe Domain Sequences for d4m93c2:

Sequence; same for both SEQRES and ATOM records:

>d4m93c2 b.1.1.2 (C:108-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

Timeline for d4m93c2:

• d4m93c2 first appeared in SCOPe 2.04
  
• d4m93c2 appears in SCOPe 2.07