| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein automated matches [190374] (15 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries) |
| Domain d4m7zc2: 4m7z C:108-214 [253773] Other proteins in same PDB: d4m7zb_, d4m7zc1, d4m7zh_, d4m7zl1 automated match to d4ma1l2 complexed with ca, nag, peg, pg4 |
PDB Entry: 4m7z (more details), 2.75 Å
SCOPe Domain Sequences for d4m7zc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4m7zc2 b.1.1.2 (C:108-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec
Timeline for d4m7zc2:
View in 3DDomains from other chains: (mouse over for more information) d4m7zb_, d4m7zh_, d4m7zl1, d4m7zl2 |