SCOPe 2.08: Domain d4m7jl1: 4m7j L:1-107

Lineage for d4m7jl1 (4m7j L:1-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)

8. Domain d4m7jl1: 4m7j L:1-107 [253769]
   Other proteins in same PDB: d4m7jl2
   automated match to d4ma1l1
   complexed with k, nag, peg

Details for d4m7jl1

PDB Entry: 4m7j, 1.95 Å

PDB Description: crystal structure of s25-26 in complex with kdo(2.8)kdo(2.4)kdo trisaccharide

PDB Compounds: (L:) S25-26 Fab (Igg1k) Light Chain

SCOPe Domain Sequences for d4m7jl1:

Sequence; same for both SEQRES and ATOM records:

>d4m7jl1 b.1.1.1 (L:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dilmnqtplslpvslgdqasiscrssqyivhrngntylewylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpytfgggtklelk

Timeline for d4m7jl1:

• d4m7jl1 first appeared in SCOPe 2.04
  
• d4m7jl1 appears in SCOPe 2.07