SCOPe 2.05: Domain d1vqga_: 1vqg A:

Lineage for d1vqga_ (1vqg A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.7: Phage ssDNA-binding proteins [50315] (4 proteins)
   barrel, open; n*=5, S*=8; the members' structures vary greater that those from cellular organisms

6. Protein Gene V protein [50316] (2 species)

7. Species Enterobacteria phage M13, including coliphage f1 [TaxId:10870] [50317] (19 PDB entries)

8. Domain d1vqga_: 1vqg A: [25376]
   mutant

Details for d1vqga_

PDB Entry: 1vqg, 1.82 Å

PDB Description: gene v protein mutant with ile 47 replaced by leu 47 (i47l)

PDB Compounds: (A:) gene v protein

SCOPe Domain Sequences for d1vqga_:

Sequence; same for both SEQRES and ATOM records:

>d1vqga_ b.40.4.7 (A:) Gene V protein {Enterobacteria phage M13, including coliphage f1 [TaxId: 10870]}
mikveikpsqaqfttrsgvsrqgkpyslneqlcyvdlgneypvlvkltldegqpayapgl
ytvhlssfkvgqfgslmidrlrlvpa

Timeline for d1vqga_:

• d1vqga_ first appeared (with stable ids) in SCOP 1.55, called d1vqg__
  
• d1vqga_ appears in SCOPe 2.04
  
• d1vqga_ appears in SCOPe 2.06
  
• d1vqga_ appears in the current release, SCOPe 2.08