SCOPe 2.06: Domain d4m5va1: 4m5v A:1-195

Lineage for d4m5va1 (4m5v A:1-195)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (36 families)

5. Family c.52.1.34: PA N-terminal domain [254166] (2 proteins)
   Pfam PF00603; relationship to endonucleases discussed in PubMed 19194458

6. Protein PA N-terminal domain [254375] (5 species)

7. Species Influenza a virus (a/lima/wrair1695p/2009(h1n1)) [TaxId:985958] [256341] (11 PDB entries)

8. Domain d4m5va1: 4m5v A:1-195 [253756]
   Other proteins in same PDB: d4m5va2
   automated match to d3ebja_
   complexed with ca, so4

Details for d4m5va1

PDB Entry: 4m5v, 1.8 Å

PDB Description: influenza 2009 h1n1 endonuclease with 100 millimolar calcium

PDB Compounds: (A:) polymerase pa

SCOPe Domain Sequences for d4m5va1:

Sequence; same for both SEQRES and ATOM records:

>d4m5va1 c.52.1.34 (A:1-195) PA N-terminal domain {Influenza a virus (a/lima/wrair1695p/2009(h1n1)) [TaxId: 985958]}
medfvrqcfnpmivelaekamkeygedpkietnkfaaicthlevcfmysdfhfiderges
iivesgdpnallkhrfeiiegrdrimawtvvnsicnttgvekpkflpdlydykenrfiei
gvtrrevhiyylekankiksekthihifsftgeematkadytldeesrariktrlftirq
emasrslwdsfrqse

Timeline for d4m5va1:

• d4m5va1 first appeared in SCOPe 2.04, called d4m5va_
  
• d4m5va1 was called d4m5va_ in SCOPe 2.05
  
• d4m5va1 appears in SCOPe 2.07
  
• d4m5va1 appears in the current release, SCOPe 2.08