Lineage for d4m5va1 (4m5v A:1-195)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2459948Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2459949Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) (S)
  5. 2460385Family c.52.1.34: PA N-terminal domain [254166] (2 protein domains)
    Pfam PF00603; relationship to endonucleases discussed in PubMed 19194458
  6. 2460386Protein PA N-terminal domain [254375] (5 species)
  7. 2460387Species Influenza A virus (a/lima/wrair1695p/2009(h1n1)) [TaxId:985958] [256341] (11 PDB entries)
  8. 2460396Domain d4m5va1: 4m5v A:1-195 [253756]
    Other proteins in same PDB: d4m5va2
    automated match to d3ebja_
    complexed with ca, so4

Details for d4m5va1

PDB Entry: 4m5v (more details), 1.8 Å

PDB Description: influenza 2009 h1n1 endonuclease with 100 millimolar calcium
PDB Compounds: (A:) polymerase pa

SCOPe Domain Sequences for d4m5va1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m5va1 c.52.1.34 (A:1-195) PA N-terminal domain {Influenza A virus (a/lima/wrair1695p/2009(h1n1)) [TaxId: 985958]}
medfvrqcfnpmivelaekamkeygedpkietnkfaaicthlevcfmysdfhfiderges
iivesgdpnallkhrfeiiegrdrimawtvvnsicnttgvekpkflpdlydykenrfiei
gvtrrevhiyylekankiksekthihifsftgeematkadytldeesrariktrlftirq
emasrslwdsfrqse

SCOPe Domain Coordinates for d4m5va1:

Click to download the PDB-style file with coordinates for d4m5va1.
(The format of our PDB-style files is described here.)

Timeline for d4m5va1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4m5va2