Lineage for d4m5oa_ (4m5o A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1856505Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 1856506Superfamily c.52.1: Restriction endonuclease-like [52980] (35 families) (S)
  5. 1856940Family c.52.1.34: PA N-terminal domain [254166] (2 proteins)
    Pfam PF00603; relationship to endonucleases discussed in PubMed 19194458
  6. 1856941Protein PA N-terminal domain [254375] (5 species)
  7. 1856942Species Influenza a virus (a/lima/wrair1695p/2009(h1n1)) [TaxId:985958] [256341] (11 PDB entries)
  8. 1856951Domain d4m5oa_: 4m5o A: [253752]
    automated match to d3ebja_
    protein/RNA complex; complexed with edo, mn, so4, x48

Details for d4m5oa_

PDB Entry: 4m5o (more details), 2 Å

PDB Description: 3-hydroxy-6-phenyl-1,2-dihydropyridin-2-one bound to influenza 2009 h1n1 endonuclease
PDB Compounds: (A:) polymerase pa

SCOPe Domain Sequences for d4m5oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m5oa_ c.52.1.34 (A:) PA N-terminal domain {Influenza a virus (a/lima/wrair1695p/2009(h1n1)) [TaxId: 985958]}
gplgsmedfvrqcfnpmivelaekamkeygedpkietnkfaaicthlevcfmysdfhfid
ergesiivesgdpnallkhrfeiiegrdrimawtvvnsicnttgvekpkflpdlydyken
rfieigvtrrevhiyylekankiksekthihifsftgeematkadytldeesrariktrl
ftirqemasrslwdsfrqse

SCOPe Domain Coordinates for d4m5oa_:

Click to download the PDB-style file with coordinates for d4m5oa_.
(The format of our PDB-style files is described here.)

Timeline for d4m5oa_: