|  | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) | 
|  | Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest | 
|  | Superfamily c.52.1: Restriction endonuclease-like [52980] (35 families)  | 
|  | Family c.52.1.34: PA N-terminal domain [254166] (2 proteins) Pfam PF00603; relationship to endonucleases discussed in PubMed 19194458 | 
|  | Protein PA N-terminal domain [254375] (5 species) | 
|  | Species Influenza a virus (a/lima/wrair1695p/2009(h1n1)) [TaxId:985958] [256341] (11 PDB entries) | 
|  | Domain d4m5oa_: 4m5o A: [253752] automated match to d3ebja_ protein/RNA complex; complexed with edo, mn, so4, x48 | 
PDB Entry: 4m5o (more details), 2 Å
SCOPe Domain Sequences for d4m5oa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4m5oa_ c.52.1.34 (A:) PA N-terminal domain {Influenza a virus (a/lima/wrair1695p/2009(h1n1)) [TaxId: 985958]}
gplgsmedfvrqcfnpmivelaekamkeygedpkietnkfaaicthlevcfmysdfhfid
ergesiivesgdpnallkhrfeiiegrdrimawtvvnsicnttgvekpkflpdlydyken
rfieigvtrrevhiyylekankiksekthihifsftgeematkadytldeesrariktrl
ftirqemasrslwdsfrqse
Timeline for d4m5oa_: