Lineage for d4m4sa1 (4m4s A:2-206)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1845934Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1846369Protein Initiation factor eIF2 gamma subunit, N-terminal (G) domain [75204] (3 species)
    includes rubredoxin-like zinc finger insert domain, res. 56-83, similar that of the Nop10-like family (144211)
  7. 1846378Species Sulfolobus solfataricus [TaxId:2287] [142227] (10 PDB entries)
    Uniprot Q980A5 2-206
  8. 1846381Domain d4m4sa1: 4m4s A:2-206 [253746]
    Other proteins in same PDB: d4m4sa2, d4m4sa3
    automated match to d2qn6a3
    protein/RNA complex; complexed with fmt, gdp, mg, na

Details for d4m4sa1

PDB Entry: 4m4s (more details), 2.25 Å

PDB Description: gamma subunit of the translation initiation factor 2 from sulfolobus solfataricus in complex with gdp and formate ion mimic aif2gamma*gdp*pi complex (a formate ion substitutes for pi)
PDB Compounds: (A:) Translation initiation factor 2 subunit gamma

SCOPe Domain Sequences for d4m4sa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m4sa1 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]}
awpkvqpevnigvvghvdhgkttlvqaitgiwtskhseelkrgmtiklgyaetnigvces
ckkpeayvtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaan
epfpqpqtrehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpii
pvsalhkinidsliegieeyiktpy

SCOPe Domain Coordinates for d4m4sa1:

Click to download the PDB-style file with coordinates for d4m4sa1.
(The format of our PDB-style files is described here.)

Timeline for d4m4sa1: