![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
![]() | Protein Initiation factor eIF2 gamma subunit, N-terminal (G) domain [75204] (3 species) includes rubredoxin-like zinc finger insert domain, res. 56-83, similar that of the Nop10-like family (144211) |
![]() | Species Sulfolobus solfataricus [TaxId:2287] [142227] (10 PDB entries) Uniprot Q980A5 2-206 |
![]() | Domain d4m4sa1: 4m4s A:2-206 [253746] Other proteins in same PDB: d4m4sa2, d4m4sa3 automated match to d2qn6a3 protein/RNA complex; complexed with fmt, gdp, mg, na |
PDB Entry: 4m4s (more details), 2.25 Å
SCOPe Domain Sequences for d4m4sa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4m4sa1 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} awpkvqpevnigvvghvdhgkttlvqaitgiwtskhseelkrgmtiklgyaetnigvces ckkpeayvtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaan epfpqpqtrehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpii pvsalhkinidsliegieeyiktpy
Timeline for d4m4sa1: