Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
Superfamily c.52.1: Restriction endonuclease-like [52980] (36 families) |
Family c.52.1.34: PA N-terminal domain [254166] (2 proteins) Pfam PF00603; relationship to endonucleases discussed in PubMed 19194458 |
Protein PA N-terminal domain [254375] (5 species) |
Species Influenza a virus (a/lima/wrair1695p/2009(h1n1)) [TaxId:985958] [256341] (11 PDB entries) |
Domain d4m4qa1: 4m4q A:1-195 [253741] Other proteins in same PDB: d4m4qa2 automated match to d3ebja_ protein/RNA complex; complexed with 21a, mg, mn, so4 |
PDB Entry: 4m4q (more details), 2.5 Å
SCOPe Domain Sequences for d4m4qa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4m4qa1 c.52.1.34 (A:1-195) PA N-terminal domain {Influenza a virus (a/lima/wrair1695p/2009(h1n1)) [TaxId: 985958]} medfvrqcfnpmivelaekamkeygedpkietnkfaaicthlevcfmysdfhfiderges iivesgdpnallkhrfeiiegrdrimawtvvnsicnttgvekpkflpdlydykenrfiei gvtrrevhiyylekankiksekthihifsftgeematkadytldeesrariktrlftirq emasrslwdsfrqse
Timeline for d4m4qa1: