SCOPe 2.06: Domain d4m4qa1: 4m4q A:1-195

Lineage for d4m4qa1 (4m4q A:1-195)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (36 families)

5. Family c.52.1.34: PA N-terminal domain [254166] (2 proteins)
   Pfam PF00603; relationship to endonucleases discussed in PubMed 19194458

6. Protein PA N-terminal domain [254375] (5 species)

7. Species Influenza a virus (a/lima/wrair1695p/2009(h1n1)) [TaxId:985958] [256341] (11 PDB entries)

8. Domain d4m4qa1: 4m4q A:1-195 [253741]
   Other proteins in same PDB: d4m4qa2
   automated match to d3ebja_
   protein/RNA complex; complexed with 21a, mg, mn, so4

Details for d4m4qa1

PDB Entry: 4m4q, 2.5 Å

PDB Description: 6-(4-fluorophenyl)-3-hydroxy-5-[4-(1H-1,2,3,4-tetrazol-5-yl)phenyl] -1,2-dihydropyridin-2-one bound to influenza 2009 H1N1 endonuclease

PDB Compounds: (A:) polymerase pa

SCOPe Domain Sequences for d4m4qa1:

Sequence; same for both SEQRES and ATOM records:

>d4m4qa1 c.52.1.34 (A:1-195) PA N-terminal domain {Influenza a virus (a/lima/wrair1695p/2009(h1n1)) [TaxId: 985958]}
medfvrqcfnpmivelaekamkeygedpkietnkfaaicthlevcfmysdfhfiderges
iivesgdpnallkhrfeiiegrdrimawtvvnsicnttgvekpkflpdlydykenrfiei
gvtrrevhiyylekankiksekthihifsftgeematkadytldeesrariktrlftirq
emasrslwdsfrqse

Timeline for d4m4qa1:

• d4m4qa1 first appeared in SCOPe 2.04, called d4m4qa_
  
• d4m4qa1 was called d4m4qa_ in SCOPe 2.05
  
• d4m4qa1 appears in SCOPe 2.07
  
• d4m4qa1 appears in the current release, SCOPe 2.08