SCOPe 2.05: Domain d4m4ea_: 4m4e A:

Lineage for d4m4ea_ (4m4e A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.8: TRAF domain-like [49598] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.8.1: TRAF domain-like [49599] (3 families)
   has a circularly permuted immunoglobulin-fold topology with extra strand

5. Family b.8.1.0: automated matches [227285] (1 protein)
   not a true family

6. Protein automated matches [227102] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [256340] (2 PDB entries)

8. Domain d4m4ea_: 4m4e A: [253738]
   automated match to d1lb4a_

Details for d4m4ea_

PDB Entry: 4m4e, 2.6 Å

PDB Description: TRAF domain of human TRAF4

PDB Compounds: (A:) TNF receptor-associated factor 4

SCOPe Domain Sequences for d4m4ea_:

Sequence, based on SEQRES records:

>d4m4ea_ b.8.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eleelsvgsdgvliwkigsygrrlqeakakpnlecfspafythkygyklqvsaflngngs
gegthlslyirvlpgafdnllewpfarrvtfslldqsdpglakpqhvtetfhpdpnwknf
qkpgtwrgsldesslgfgypkfishqdirkrnyvrddavfiraavelp

Sequence, based on observed residues (ATOM records):

>d4m4ea_ b.8.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eleelsvgsdgvliwkigsygrrlqeakakpnlecfspafythkygyklqvsaflngngs
gegthlslyirvlpgafdnllewpfarrvtfslldqsdpglakpqhvtetfhpdpnwknf
qkpgtlgfgypkfishqdirkrnyvrddavfiraavelp

Timeline for d4m4ea_:

• d4m4ea_ first appeared in SCOPe 2.04
  
• d4m4ea_ appears in SCOPe 2.06
  
• d4m4ea_ appears in the current release, SCOPe 2.08