Lineage for d4m2la3 (4m2l A:321-415)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2793864Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2793865Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) (S)
    probably related to the second domain and its superfamiy by a circular permutation
  5. 2793866Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (7 proteins)
  6. 2793941Protein Initiation factor eIF2 gamma subunit [74964] (3 species)
  7. 2793950Species Sulfolobus solfataricus [TaxId:2287] [141344] (10 PDB entries)
    Uniprot Q980A5 321-415
  8. 2793953Domain d4m2la3: 4m2l A:321-415 [253737]
    Other proteins in same PDB: d4m2la1, d4m2la2
    automated match to d2qn6a2
    complexed with edo, po4, so4

Details for d4m2la3

PDB Entry: 4m2l (more details), 2.15 Å

PDB Description: gamma subunit of the translation initiation factor 2 from sulfolobus solfataricus in nucleotide-free form
PDB Compounds: (A:) Translation initiation factor 2 subunit gamma

SCOPe Domain Sequences for d4m2la3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m2la3 b.44.1.1 (A:321-415) Initiation factor eIF2 gamma subunit {Sulfolobus solfataricus [TaxId: 2287]}
aevpvlwnirikynllervvgakemlkvdpiraketlmlsvgssttlgivtsvkkdeiev
elrrpvavwsnnirtvisrqiagrwrmigwglvei

SCOPe Domain Coordinates for d4m2la3:

Click to download the PDB-style file with coordinates for d4m2la3.
(The format of our PDB-style files is described here.)

Timeline for d4m2la3: