Lineage for d4m2la2 (4m2l A:207-320)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1791673Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1791735Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 1791736Family b.43.3.1: Elongation factors [50448] (10 proteins)
  6. 1791869Protein Initiation factor eIF2 gamma subunit, domain II [74962] (3 species)
  7. 1791878Species Sulfolobus solfataricus [TaxId:2287] [141335] (10 PDB entries)
    Uniprot Q980A5 207-320
  8. 1791882Domain d4m2la2: 4m2l A:207-320 [253736]
    Other proteins in same PDB: d4m2la1, d4m2la3
    automated match to d2qn6a1
    complexed with edo, po4, so4

Details for d4m2la2

PDB Entry: 4m2l (more details), 2.15 Å

PDB Description: gamma subunit of the translation initiation factor 2 from sulfolobus solfataricus in nucleotide-free form
PDB Compounds: (A:) Translation initiation factor 2 subunit gamma

SCOPe Domain Sequences for d4m2la2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m2la2 b.43.3.1 (A:207-320) Initiation factor eIF2 gamma subunit, domain II {Sulfolobus solfataricus [TaxId: 2287]}
rdlsqkpvmlvirsfdvnkpgtqfnelkggviggsiiqglfkvdqeikvlpglrvekqgk
vsyepiftkissirfgdeefkeakpgglvaigtyldpsltkadnllgsiitlad

SCOPe Domain Coordinates for d4m2la2:

Click to download the PDB-style file with coordinates for d4m2la2.
(The format of our PDB-style files is described here.)

Timeline for d4m2la2: