![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
![]() | Superfamily b.43.3: Translation proteins [50447] (7 families) ![]() |
![]() | Family b.43.3.1: Elongation factors [50448] (10 proteins) |
![]() | Protein Initiation factor eIF2 gamma subunit, domain II [74962] (3 species) |
![]() | Species Sulfolobus solfataricus [TaxId:2287] [141335] (10 PDB entries) Uniprot Q980A5 207-320 |
![]() | Domain d4m2la2: 4m2l A:207-320 [253736] Other proteins in same PDB: d4m2la1, d4m2la3 automated match to d2qn6a1 complexed with edo, po4, so4 |
PDB Entry: 4m2l (more details), 2.15 Å
SCOPe Domain Sequences for d4m2la2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4m2la2 b.43.3.1 (A:207-320) Initiation factor eIF2 gamma subunit, domain II {Sulfolobus solfataricus [TaxId: 2287]} rdlsqkpvmlvirsfdvnkpgtqfnelkggviggsiiqglfkvdqeikvlpglrvekqgk vsyepiftkissirfgdeefkeakpgglvaigtyldpsltkadnllgsiitlad
Timeline for d4m2la2: