Lineage for d4m1ic_ (4m1i C:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1727563Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1727564Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1729174Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. 1729468Protein automated matches [190435] (9 species)
    not a true protein
  7. 1729485Species Chlamydia trachomatis [TaxId:813] [225098] (5 PDB entries)
  8. 1729496Domain d4m1ic_: 4m1i C: [253733]
    automated match to d2ania_
    complexed with acy, fe, mn, p6g

Details for d4m1ic_

PDB Entry: 4m1i (more details), 1.8 Å

PDB Description: X-ray crystal structure of Chlamydia trachomatis Mn(II)Fe(II)-NrdB
PDB Compounds: (C:) Ribonucleoside-diphosphate reductase subunit beta

SCOPe Domain Sequences for d4m1ic_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m1ic_ a.25.1.2 (C:) automated matches {Chlamydia trachomatis [TaxId: 813]}
vprgshmqadildgkqkrvnlnskrlvncnqvdvnqlvpikykwawehylngcannwlpt
eipmgkdielwksdrlsederrvillnlgffstaeslvgnnivlaifkhvtnpearqyll
rqafeeavhthtflyiceslgldekeifnayneraaikakddfqmeitgkvldpnfrtds
veglqefvknlvgyyiimegiffysgfvmilsfhrqnkmigigeqyqyilrdetihlnfg
idlingikeenpeiwtpelqqeivelikravdleieyaqdclprgilglrasmfidyvqh
iadrrleriglkpiyhtknpfpwmsetidlnke

SCOPe Domain Coordinates for d4m1ic_:

Click to download the PDB-style file with coordinates for d4m1ic_.
(The format of our PDB-style files is described here.)

Timeline for d4m1ic_: