SCOPe 2.04: Domain d4m1ic_: 4m1i C:

Lineage for d4m1ic_ (4m1i C:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)

6. Protein automated matches [190435] (9 species)
   not a true protein

7. Species Chlamydia trachomatis [TaxId:813] [225098] (5 PDB entries)

8. Domain d4m1ic_: 4m1i C: [253733]
   automated match to d2ania_
   complexed with acy, fe, mn, p6g

Details for d4m1ic_

PDB Entry: 4m1i, 1.8 Å

PDB Description: X-ray crystal structure of Chlamydia trachomatis Mn(II)Fe(II)-NrdB

PDB Compounds: (C:) Ribonucleoside-diphosphate reductase subunit beta

SCOPe Domain Sequences for d4m1ic_:

Sequence; same for both SEQRES and ATOM records:

>d4m1ic_ a.25.1.2 (C:) automated matches {Chlamydia trachomatis [TaxId: 813]}
vprgshmqadildgkqkrvnlnskrlvncnqvdvnqlvpikykwawehylngcannwlpt
eipmgkdielwksdrlsederrvillnlgffstaeslvgnnivlaifkhvtnpearqyll
rqafeeavhthtflyiceslgldekeifnayneraaikakddfqmeitgkvldpnfrtds
veglqefvknlvgyyiimegiffysgfvmilsfhrqnkmigigeqyqyilrdetihlnfg
idlingikeenpeiwtpelqqeivelikravdleieyaqdclprgilglrasmfidyvqh
iadrrleriglkpiyhtknpfpwmsetidlnke

Timeline for d4m1ic_:

• d4m1ic_ is new in SCOPe 2.04-stable
  
• d4m1ic_ appears in SCOPe 2.05
  
• d4m1ic_ appears in the current release, SCOPe 2.08, called d4m1ic1