SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4m1ib1 (4m1i B:1-320)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1988413Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1988414Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1990025Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 protein domains)
  6. 1990319Protein automated matches [190435] (11 species)
    not a true protein
  7. 1990336Species Chlamydia trachomatis [TaxId:813] [225098] (5 PDB entries)
  8. 1990346Domain d4m1ib1: 4m1i B:1-320 [253732]
    Other proteins in same PDB: d4m1ia2, d4m1ib2, d4m1ic2, d4m1id2
    automated match to d2ania_
    complexed with acy, fe, mn, p6g

Details for d4m1ib1

PDB Entry: 4m1i (more details), 1.8 Å

PDB Description: X-ray crystal structure of Chlamydia trachomatis Mn(II)Fe(II)-NrdB
PDB Compounds: (B:) Ribonucleoside-diphosphate reductase subunit beta

SCOPe Domain Sequences for d4m1ib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m1ib1 a.25.1.2 (B:1-320) automated matches {Chlamydia trachomatis [TaxId: 813]}
mqadildgkqkrvnlnskrlvncnqvdvnqlvpikykwawehylngcannwlpteipmgk
dielwksdrlsederrvillnlgffstaeslvgnnivlaifkhvtnpearqyllrqafee
avhthtflyiceslgldekeifnayneraaikakddfqmeitgkvldpnfrtdsveglqe
fvknlvgyyiimegiffysgfvmilsfhrqnkmigigeqyqyilrdetihlnfgidling
ikeenpeiwtpelqqeivelikravdleieyaqdclprgilglrasmfidyvqhiadrrl
eriglkpiyhtknpfpwmse

SCOPe Domain Coordinates for d4m1ib1:

Click to download the PDB-style file with coordinates for d4m1ib1.
(The format of our PDB-style files is described here.)

Timeline for d4m1ib1: