Lineage for d1vqf__ (1vqf -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13574Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 14052Superfamily b.40.4: Nucleic acid-binding proteins [50249] (8 families) (S)
  5. 14248Family b.40.4.7: Filamentous bacteriophage ssDNA-binding proteins [50315] (2 proteins)
  6. 14252Protein Gene V protein [50316] (2 species)
  7. 14253Species Filamentous bacteriophage (f1, M13) [50317] (19 PDB entries)
  8. 14257Domain d1vqf__: 1vqf - [25372]

Details for d1vqf__

PDB Entry: 1vqf (more details), 1.8 Å

PDB Description: gene v protein mutant with val 35 replaced by ile 35 and ile 47 replaced by val 47 (v35i, i47v)

SCOP Domain Sequences for d1vqf__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vqf__ b.40.4.7 (-) Gene V protein {Filamentous bacteriophage (f1, M13)}
mikveikpsqaqfttrsgvsrqgkpyslneqlcyidlgneypvlvkvtldegqpayapgl
ytvhlssfkvgqfgslmidrlrlvpa

SCOP Domain Coordinates for d1vqf__:

Click to download the PDB-style file with coordinates for d1vqf__.
(The format of our PDB-style files is described here.)

Timeline for d1vqf__: