![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
![]() | Protein Initiation factor eIF2 gamma subunit, N-terminal (G) domain [75204] (3 species) includes rubredoxin-like zinc finger insert domain, res. 56-83, similar that of the Nop10-like family (144211) |
![]() | Species Sulfolobus solfataricus [TaxId:2287] [142227] (10 PDB entries) Uniprot Q980A5 2-206 |
![]() | Domain d4m0la1: 4m0l A:2-206 [253708] Other proteins in same PDB: d4m0la2, d4m0la3, d4m0lb2, d4m0lb3, d4m0lc2, d4m0lc3, d4m0ld2, d4m0ld3, d4m0le2, d4m0le3, d4m0lf2, d4m0lf3 automated match to d2qn6a3 protein/RNA complex; complexed with gdp, mg, po4 |
PDB Entry: 4m0l (more details), 2.6 Å
SCOPe Domain Sequences for d4m0la1:
Sequence, based on SEQRES records: (download)
>d4m0la1 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} awpkvqpevnigvvghvdhgkttlvqaitgiwtskhseelkrgmtiklgyaetnigvces ckkpeayvtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaan epfpqpqtrehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpii pvsalhkinidsliegieeyiktpy
>d4m0la1 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} awpkvqpevnigvvghvdhgkttlvqaitgiwtskhseelkmtiklgyaetnigvcesck kpeayvtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaanep fpqpqtrehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpiipv salhkinidsliegieeyiktpy
Timeline for d4m0la1: