SCOPe 2.04: Domain d4lzra_: 4lzr A:

Lineage for d4lzra_ (4lzr A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187641] (182 PDB entries)

8. Domain d4lzra_: 4lzr A: [253707]
   automated match to d4nrba_
   complexed with loc

Details for d4lzra_

PDB Entry: 4lzr, 1.85 Å

PDB Description: Crystal Structure of BRD4(1) bound to Colchicine

PDB Compounds: (A:) Bromodomain-containing protein 4

SCOPe Domain Sequences for d4lzra_:

Sequence; same for both SEQRES and ATOM records:

>d4lzra_ a.29.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
amnppppetsnpnkpkrqtnqleyllrvvlktlwkhqfawpfqqpvdavklnlpdyykii
ktpmdmgtikkrlednyywnaqeciqdfntmftncyiynkpgddivlmaealeslflqki
nelptee

Timeline for d4lzra_:

• d4lzra_ is new in SCOPe 2.04-stable
  
• d4lzra_ appears in SCOPe 2.05
  
• d4lzra_ appears in the current release, SCOPe 2.08, called d4lzra1