SCOPe 2.08: Domain d4lueb3: 4lue B:250-530

Lineage for d4lueb3 (4lue B:250-530)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Haemopoetic cell kinase Hck [56151] (1 species)
   PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [56152] (25 PDB entries)

8. Domain d4lueb3: 4lue B:250-530 [253699]
   Other proteins in same PDB: d4luea1, d4luea2, d4luea4, d4lueb1, d4lueb2, d4lueb4
   automated match to d1fmka3
   complexed with ca, cl, gol, imd, vse

Details for d4lueb3

PDB Entry: 4lue, 3.04 Å

PDB Description: crystal structure of hck in complex with 7-[trans-4-(4- methylpiperazin-1-yl)cyclohexyl]-5-(4-phenoxyphenyl)-7h-pyrrolo[2,3- d]pyrimidin-4-amine (resulting from displacement of skf86002)

PDB Compounds: (B:) Tyrosine-protein kinase HCK

SCOPe Domain Sequences for d4lueb3:

Sequence, based on SEQRES records:

>d4lueb3 d.144.1.7 (B:250-530) Haemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]}
kpqkpwekdaweipreslklekklgagqfgevwmatynkhtkvavktmkpgsmsveafla
eanvmktlqhdklvklhavvtkepiyiitefmakgslldflksdegskqplpklidfsaq
iaegmafieqrnyihrdlraanilvsaslvckiadfglarviedneytaregakfpikwt
apeainfgsftiksdvwsfgillmeivtygripypgmsnpeviralergyrmprpencpe
elynimmrcwknrpeerptfeyiqsvlddfytatesqyeei

Sequence, based on observed residues (ATOM records):

>d4lueb3 d.144.1.7 (B:250-530) Haemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]}
kpqkpwekdaweipreslklekklgagqfgevwmatynkhtkvavktmkplaeanvmktl
qhdklvklhavvtkepiyiitefmakgslldflksdegskqplpklidfsaqiaegmafi
eqrnyihrdlraanilvsaslvckiadfglarvipikwtapeainftiksdvwsfgillm
eivtygripypgmsnpeviralergyrmprpencpeelynimmrcwknrpeerptfeyiq
svlddfytatesqyeei

Timeline for d4lueb3:

• d4lueb3 first appeared in SCOPe 2.04
  
• d4lueb3 appears in SCOPe 2.07