Lineage for d4lueb3 (4lue B:250-530)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2543873Protein Haemopoetic cell kinase Hck [56151] (1 species)
    PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase
  7. 2543874Species Human (Homo sapiens) [TaxId:9606] [56152] (24 PDB entries)
  8. 2543915Domain d4lueb3: 4lue B:250-530 [253699]
    Other proteins in same PDB: d4luea1, d4luea2, d4luea4, d4lueb1, d4lueb2, d4lueb4
    automated match to d1fmka3
    complexed with ca, cl, gol, imd, vse

Details for d4lueb3

PDB Entry: 4lue (more details), 3.04 Å

PDB Description: Crystal Structure of HCK in complex with 7-[trans-4-(4-methylpiperazin-1-yl)cyclohexyl]-5-(4-phenoxyphenyl)-7H-pyrrolo[2,3-d]pyrimidin-4-amine (resulting from displacement of SKF86002)
PDB Compounds: (B:) Tyrosine-protein kinase HCK

SCOPe Domain Sequences for d4lueb3:

Sequence, based on SEQRES records: (download)

>d4lueb3 d.144.1.7 (B:250-530) Haemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]}
kpqkpwekdaweipreslklekklgagqfgevwmatynkhtkvavktmkpgsmsveafla
eanvmktlqhdklvklhavvtkepiyiitefmakgslldflksdegskqplpklidfsaq
iaegmafieqrnyihrdlraanilvsaslvckiadfglarviedneytaregakfpikwt
apeainfgsftiksdvwsfgillmeivtygripypgmsnpeviralergyrmprpencpe
elynimmrcwknrpeerptfeyiqsvlddfytatesqyeei

Sequence, based on observed residues (ATOM records): (download)

>d4lueb3 d.144.1.7 (B:250-530) Haemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]}
kpqkpwekdaweipreslklekklgagqfgevwmatynkhtkvavktmkplaeanvmktl
qhdklvklhavvtkepiyiitefmakgslldflksdegskqplpklidfsaqiaegmafi
eqrnyihrdlraanilvsaslvckiadfglarvipikwtapeainftiksdvwsfgillm
eivtygripypgmsnpeviralergyrmprpencpeelynimmrcwknrpeerptfeyiq
svlddfytatesqyeei

SCOPe Domain Coordinates for d4lueb3:

Click to download the PDB-style file with coordinates for d4lueb3.
(The format of our PDB-style files is described here.)

Timeline for d4lueb3: