Lineage for d4lueb2 (4lue B:147-249)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1661863Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 1661864Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 1662297Family d.93.1.0: automated matches [191409] (1 protein)
    not a true family
  6. 1662298Protein automated matches [190561] (3 species)
    not a true protein
  7. 1662299Species Human (Homo sapiens) [TaxId:9606] [187549] (38 PDB entries)
  8. 1662344Domain d4lueb2: 4lue B:147-249 [253698]
    Other proteins in same PDB: d4luea1, d4luea3, d4lueb1, d4lueb3
    automated match to d1fmka2
    complexed with ca, cl, gol, imd, vse

Details for d4lueb2

PDB Entry: 4lue (more details), 3.04 Å

PDB Description: crystal structure of hck in complex with 7-[trans-4-(4- methylpiperazin-1-yl)cyclohexyl]-5-(4-phenoxyphenyl)-7h-pyrrolo[2,3- d]pyrimidin-4-amine (resulting from displacement of skf86002)
PDB Compounds: (B:) Tyrosine-protein kinase HCK

SCOPe Domain Sequences for d4lueb2:

Sequence, based on SEQRES records: (download)

>d4lueb2 d.93.1.0 (B:147-249) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eewffkgisrkdaerqllapgnmlgsfmirdsettkgsyslsvrdydprqgdtvkhykir
tldnggfyisprstfstlqelvdhykkgndglcqklsvpcmss

Sequence, based on observed residues (ATOM records): (download)

>d4lueb2 d.93.1.0 (B:147-249) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eewffkgisrkdaerqllapgnmlgsfmirdsettkgsyslsvrdydprqgdtvkhykir
tgfyisprstfstlqelvdhykkgndglcqklsvpcmss

SCOPe Domain Coordinates for d4lueb2:

Click to download the PDB-style file with coordinates for d4lueb2.
(The format of our PDB-style files is described here.)

Timeline for d4lueb2: