SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4lueb1 (4lue B:86-146)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2045654Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2045783Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2046226Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 2046227Protein automated matches [190457] (9 species)
    not a true protein
  7. 2046277Species Human (Homo sapiens) [TaxId:9606] [187598] (88 PDB entries)
  8. 2046345Domain d4lueb1: 4lue B:86-146 [253697]
    Other proteins in same PDB: d4luea2, d4luea3, d4luea4, d4lueb2, d4lueb3, d4lueb4
    automated match to d1fmka1
    complexed with ca, cl, gol, imd, vse

Details for d4lueb1

PDB Entry: 4lue (more details), 3.04 Å

PDB Description: Crystal Structure of HCK in complex with 7-[trans-4-(4-methylpiperazin-1-yl)cyclohexyl]-5-(4-phenoxyphenyl)-7H-pyrrolo[2,3-d]pyrimidin-4-amine (resulting from displacement of SKF86002)
PDB Compounds: (B:) Tyrosine-protein kinase HCK

SCOPe Domain Sequences for d4lueb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lueb1 b.34.2.0 (B:86-146) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iivvalydyeaihhedlsfqkgdqmvvleesgewwkarslatrkegyipsnyvarvdsle
t

SCOPe Domain Coordinates for d4lueb1:

Click to download the PDB-style file with coordinates for d4lueb1.
(The format of our PDB-style files is described here.)

Timeline for d4lueb1: