Class b: All beta proteins [48724] (180 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) |
Family b.34.2.0: automated matches [191375] (1 protein) not a true family |
Protein automated matches [190457] (10 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187598] (105 PDB entries) |
Domain d4lueb1: 4lue B:86-146 [253697] Other proteins in same PDB: d4luea2, d4luea3, d4luea4, d4lueb2, d4lueb3, d4lueb4 automated match to d1fmka1 complexed with ca, cl, gol, imd, vse |
PDB Entry: 4lue (more details), 3.04 Å
SCOPe Domain Sequences for d4lueb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lueb1 b.34.2.0 (B:86-146) automated matches {Human (Homo sapiens) [TaxId: 9606]} iivvalydyeaihhedlsfqkgdqmvvleesgewwkarslatrkegyipsnyvarvdsle t
Timeline for d4lueb1:
View in 3D Domains from other chains: (mouse over for more information) d4luea1, d4luea2, d4luea3, d4luea4 |