Lineage for d4lueb1 (4lue B:86-146)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2045654Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2045783Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2046226Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 2046227Protein automated matches [190457] (9 species)
    not a true protein
  7. 2046277Species Human (Homo sapiens) [TaxId:9606] [187598] (88 PDB entries)
  8. 2046345Domain d4lueb1: 4lue B:86-146 [253697]
    Other proteins in same PDB: d4luea2, d4luea3, d4luea4, d4lueb2, d4lueb3, d4lueb4
    automated match to d1fmka1
    complexed with ca, cl, gol, imd, vse

Details for d4lueb1

PDB Entry: 4lue (more details), 3.04 Å

PDB Description: Crystal Structure of HCK in complex with 7-[trans-4-(4-methylpiperazin-1-yl)cyclohexyl]-5-(4-phenoxyphenyl)-7H-pyrrolo[2,3-d]pyrimidin-4-amine (resulting from displacement of SKF86002)
PDB Compounds: (B:) Tyrosine-protein kinase HCK

SCOPe Domain Sequences for d4lueb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lueb1 b.34.2.0 (B:86-146) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iivvalydyeaihhedlsfqkgdqmvvleesgewwkarslatrkegyipsnyvarvdsle
t

SCOPe Domain Coordinates for d4lueb1:

Click to download the PDB-style file with coordinates for d4lueb1.
(The format of our PDB-style files is described here.)

Timeline for d4lueb1: