SCOPe 2.04: Domain d4luea2: 4lue A:147-249

Lineage for d4luea2 (4lue A:147-249)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.0: automated matches [191409] (1 protein)
   not a true family

6. Protein automated matches [190561] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187549] (38 PDB entries)

8. Domain d4luea2: 4lue A:147-249 [253695]
   Other proteins in same PDB: d4luea1, d4luea3, d4lueb1, d4lueb3
   automated match to d1fmka2
   complexed with ca, cl, gol, imd, vse

Details for d4luea2

PDB Entry: 4lue, 3.04 Å

PDB Description: crystal structure of hck in complex with 7-[trans-4-(4- methylpiperazin-1-yl)cyclohexyl]-5-(4-phenoxyphenyl)-7h-pyrrolo[2,3- d]pyrimidin-4-amine (resulting from displacement of skf86002)

PDB Compounds: (A:) Tyrosine-protein kinase HCK

SCOPe Domain Sequences for d4luea2:

Sequence, based on SEQRES records:

>d4luea2 d.93.1.0 (A:147-249) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eewffkgisrkdaerqllapgnmlgsfmirdsettkgsyslsvrdydprqgdtvkhykir
tldnggfyisprstfstlqelvdhykkgndglcqklsvpcmss

Sequence, based on observed residues (ATOM records):

>d4luea2 d.93.1.0 (A:147-249) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eewffkgisrkdaerqllapgnmlgsfmirdsettkgsyslsvrdydprqgdtvkhykir
tgfyisprstfstlqelvdhykkgndglcqklsvpcmss

Timeline for d4luea2:

• d4luea2 is new in SCOPe 2.04-stable
  
• d4luea2 appears in SCOPe 2.05
  
• d4luea2 appears in the current release, SCOPe 2.08