Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices |
Superfamily d.93.1: SH2 domain [55550] (2 families) |
Family d.93.1.0: automated matches [191409] (1 protein) not a true family |
Protein automated matches [190561] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187549] (77 PDB entries) |
Domain d4luea2: 4lue A:147-249 [253695] Other proteins in same PDB: d4luea1, d4luea3, d4luea4, d4lueb1, d4lueb3, d4lueb4 automated match to d1fmka2 complexed with ca, cl, gol, imd, vse |
PDB Entry: 4lue (more details), 3.04 Å
SCOPe Domain Sequences for d4luea2:
Sequence, based on SEQRES records: (download)
>d4luea2 d.93.1.0 (A:147-249) automated matches {Human (Homo sapiens) [TaxId: 9606]} eewffkgisrkdaerqllapgnmlgsfmirdsettkgsyslsvrdydprqgdtvkhykir tldnggfyisprstfstlqelvdhykkgndglcqklsvpcmss
>d4luea2 d.93.1.0 (A:147-249) automated matches {Human (Homo sapiens) [TaxId: 9606]} eewffkgisrkdaerqllapgnmlgsfmirdsettkgsyslsvrdydprqgdtvkhykir tgfyisprstfstlqelvdhykkgndglcqklsvpcmss
Timeline for d4luea2:
View in 3D Domains from other chains: (mouse over for more information) d4lueb1, d4lueb2, d4lueb3, d4lueb4 |