SCOPe 2.04: Domain d4luea1: 4lue A:85-146

Lineage for d4luea1 (4lue A:85-146)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.0: automated matches [191375] (1 protein)
   not a true family

6. Protein automated matches [190457] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187598] (77 PDB entries)

8. Domain d4luea1: 4lue A:85-146 [253694]
   Other proteins in same PDB: d4luea2, d4luea3, d4lueb2, d4lueb3
   automated match to d1fmka1
   complexed with ca, cl, gol, imd, vse

Details for d4luea1

PDB Entry: 4lue, 3.04 Å

PDB Description: crystal structure of hck in complex with 7-[trans-4-(4- methylpiperazin-1-yl)cyclohexyl]-5-(4-phenoxyphenyl)-7h-pyrrolo[2,3- d]pyrimidin-4-amine (resulting from displacement of skf86002)

PDB Compounds: (A:) Tyrosine-protein kinase HCK

SCOPe Domain Sequences for d4luea1:

Sequence; same for both SEQRES and ATOM records:

>d4luea1 b.34.2.0 (A:85-146) automated matches {Human (Homo sapiens) [TaxId: 9606]}
riivvalydyeaihhedlsfqkgdqmvvleesgewwkarslatrkegyipsnyvarvdsl
et

Timeline for d4luea1:

• d4luea1 is new in SCOPe 2.04-stable
  
• d4luea1 appears in SCOPe 2.05
  
• d4luea1 appears in the current release, SCOPe 2.08