Lineage for d4lu1b_ (4lu1 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2881870Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 2882121Superfamily c.51.4: ITPase-like [52972] (4 families) (S)
    formerly Maf/Ham1; elaborated with additional structures inserted in the common fold
  5. 2882183Family c.51.4.0: automated matches [191335] (1 protein)
    not a true family
  6. 2882184Protein automated matches [190179] (9 species)
    not a true protein
  7. 2882193Species Escherichia coli K-12 [TaxId:83333] [231183] (4 PDB entries)
  8. 2882200Domain d4lu1b_: 4lu1 B: [253693]
    automated match to d4heba_
    complexed with unx; mutant

Details for d4lu1b_

PDB Entry: 4lu1 (more details), 1.92 Å

PDB Description: crystal structure of the uncharacterized maf protein ycef from e. coli, mutant d69a
PDB Compounds: (B:) Maf-like protein YceF

SCOPe Domain Sequences for d4lu1b_:

Sequence, based on SEQRES records: (download)

>d4lu1b_ c.51.4.0 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
klilastspwrralleklqisfecaapevdetprsdesprqlvlrlaqekaqslasrypd
hliigsaqvcvldgeitgkplteenarlqlrkasgnivtfytglalfnsanghlqtevep
fdvhfrhlseaeidnyvrkehplhcagsfksegfgitlferlegrdpntlvglplialcq
mlrregknplm

Sequence, based on observed residues (ATOM records): (download)

>d4lu1b_ c.51.4.0 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
klilastspwrralleklqisfecaapevdetprsdesprqlvlrlaqekaqslasrypd
hliigsaqvcvldgeitteenarlqlrkasgnivtfytglalfnsanghlqtevepfdvh
frhlseaeidnyvrkfksegfgitlferlegrdpntlvglplialcqmlrregknplm

SCOPe Domain Coordinates for d4lu1b_:

Click to download the PDB-style file with coordinates for d4lu1b_.
(The format of our PDB-style files is described here.)

Timeline for d4lu1b_: