SCOPe 2.05: Domain d4lu1a_: 4lu1 A:

Lineage for d4lu1a_ (4lu1 A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest

4. Superfamily c.51.4: ITPase-like [52972] (4 families)
   formerly Maf/Ham1; elaborated with additional structures inserted in the common fold

5. Family c.51.4.0: automated matches [191335] (1 protein)
   not a true family

6. Protein automated matches [190179] (8 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [231183] (4 PDB entries)

8. Domain d4lu1a_: 4lu1 A: [253692]
   automated match to d4heba_
   complexed with unx; mutant

Details for d4lu1a_

PDB Entry: 4lu1, 1.92 Å

PDB Description: crystal structure of the uncharacterized maf protein ycef from e. coli, mutant d69a

PDB Compounds: (A:) Maf-like protein YceF

SCOPe Domain Sequences for d4lu1a_:

Sequence; same for both SEQRES and ATOM records:

>d4lu1a_ c.51.4.0 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
klilastspwrralleklqisfecaapevdetprsdesprqlvlrlaqekaqslasrypd
hliigsaqvcvldgeitgkplteenarlqlrkasgnivtfytglalfnsanghlqtevep
fdvhfrhlseaeidnyvrkehplhcagsfksegfgitlferlegrdpntlvglplialcq
mlrregknplm

Timeline for d4lu1a_:

• d4lu1a_ first appeared in SCOPe 2.04
  
• d4lu1a_ appears in SCOPe 2.06
  
• d4lu1a_ appears in the current release, SCOPe 2.08