Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies) 3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest |
Superfamily c.51.4: ITPase-like [52972] (4 families) formerly Maf/Ham1; elaborated with additional structures inserted in the common fold |
Family c.51.4.0: automated matches [191335] (1 protein) not a true family |
Protein automated matches [190179] (8 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [231183] (4 PDB entries) |
Domain d4lu1a_: 4lu1 A: [253692] automated match to d4heba_ complexed with unx; mutant |
PDB Entry: 4lu1 (more details), 1.92 Å
SCOPe Domain Sequences for d4lu1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lu1a_ c.51.4.0 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]} klilastspwrralleklqisfecaapevdetprsdesprqlvlrlaqekaqslasrypd hliigsaqvcvldgeitgkplteenarlqlrkasgnivtfytglalfnsanghlqtevep fdvhfrhlseaeidnyvrkehplhcagsfksegfgitlferlegrdpntlvglplialcq mlrregknplm
Timeline for d4lu1a_: