Lineage for d1gvp__ (1gvp -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13574Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 14052Superfamily b.40.4: Nucleic acid-binding proteins [50249] (8 families) (S)
  5. 14248Family b.40.4.7: Filamentous bacteriophage ssDNA-binding proteins [50315] (2 proteins)
  6. 14252Protein Gene V protein [50316] (2 species)
  7. 14253Species Filamentous bacteriophage (f1, M13) [50317] (19 PDB entries)
  8. 14254Domain d1gvp__: 1gvp - [25369]

Details for d1gvp__

PDB Entry: 1gvp (more details), 1.6 Å

PDB Description: gene v protein (single-stranded dna binding protein)

SCOP Domain Sequences for d1gvp__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gvp__ b.40.4.7 (-) Gene V protein {Filamentous bacteriophage (f1, M13)}
mikveikpsqaqfttrsgvsrqgkpyslneqlcyvdlgneypvlvkitldegqpayapgl
ytvhlssfkvgqfgslmidrlrlvpak

SCOP Domain Coordinates for d1gvp__:

Click to download the PDB-style file with coordinates for d1gvp__.
(The format of our PDB-style files is described here.)

Timeline for d1gvp__: