Lineage for d4lt6a3 (4lt6 A:364-501)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2953807Superfamily d.58.16: PAP/Archaeal CCA-adding enzyme, C-terminal domain [55003] (3 families) (S)
  5. 2953863Family d.58.16.0: automated matches [254332] (1 protein)
    not a true family
  6. 2953864Protein automated matches [254757] (1 species)
    not a true protein
  7. 2953865Species Human (Homo sapiens) [TaxId:9606] [256361] (1 PDB entry)
  8. 2953866Domain d4lt6a3: 4lt6 A:364-501 [253688]
    Other proteins in same PDB: d4lt6a1, d4lt6a2, d4lt6b1, d4lt6b2
    automated match to d1q79a3
    complexed with 3at, ca

Details for d4lt6a3

PDB Entry: 4lt6 (more details), 2.79 Å

PDB Description: Crystal Structure of human poly(A) polymerase gamma
PDB Compounds: (A:) Poly(A) polymerase gamma

SCOPe Domain Sequences for d4lt6a3:

Sequence, based on SEQRES records: (download)

>d4lt6a3 d.58.16.0 (A:364-501) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pnffqkyrhyivltasasteenhlewvglveskirvlvgnlernefitlahvnpqsfpgn
kehhkdnnyvsmwflgiifrrvenaesvnidltydiqsftdtvyrqanninmlkegmkie
athvkkkqlhhylpaeil

Sequence, based on observed residues (ATOM records): (download)

>d4lt6a3 d.58.16.0 (A:364-501) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pnffqkyrhyivltasasteenhlewvglveskirvlvgnlernefitlahvnpqsfpgn
yvsmwflgiifrdltydiqsftdtvyrqanninmlkegmkieathvkkkqlhhylpaeil

SCOPe Domain Coordinates for d4lt6a3:

Click to download the PDB-style file with coordinates for d4lt6a3.
(The format of our PDB-style files is described here.)

Timeline for d4lt6a3: