![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.160: PAP/OAS1 substrate-binding domain [81632] (1 superfamily) core: 5-helical bundle; up-and-down; right-handed twist |
![]() | Superfamily a.160.1: PAP/OAS1 substrate-binding domain [81631] (7 families) ![]() this domain follows the catalytic nucleotidyltransferase domain |
![]() | Family a.160.1.0: automated matches [227288] (1 protein) not a true family |
![]() | Protein automated matches [227106] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [226560] (2 PDB entries) |
![]() | Domain d4lt6a2: 4lt6 A:214-363 [253687] Other proteins in same PDB: d4lt6a1, d4lt6a3, d4lt6b1, d4lt6b3 automated match to d1q79a1 complexed with 3at, ca |
PDB Entry: 4lt6 (more details), 2.79 Å
SCOPe Domain Sequences for d4lt6a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lt6a2 a.160.1.0 (A:214-363) automated matches {Human (Homo sapiens) [TaxId: 9606]} pnketfrltlravklwakrrgiysnmlgflggvswamlvartcqlypnaaastlvhkffl vfskwewpnpvllkqpeesnlnlpvwdprvnpsdryhlmpiitpaypqqnstynvststr tvmveefkqglavtdeilqgksdwskllep
Timeline for d4lt6a2: