SCOPe 2.08: Domain d4lt6a2: 4lt6 A:214-363

Lineage for d4lt6a2 (4lt6 A:214-363)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.160: PAP/OAS1 substrate-binding domain [81632] (1 superfamily)
   core: 5-helical bundle; up-and-down; right-handed twist

4. Superfamily a.160.1: PAP/OAS1 substrate-binding domain [81631] (7 families)
   this domain follows the catalytic nucleotidyltransferase domain

5. Family a.160.1.0: automated matches [227288] (1 protein)
   not a true family

6. Protein automated matches [227106] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226560] (2 PDB entries)

8. Domain d4lt6a2: 4lt6 A:214-363 [253687]
   Other proteins in same PDB: d4lt6a1, d4lt6a3, d4lt6b1, d4lt6b3
   automated match to d1q79a1
   complexed with 3at, ca

Details for d4lt6a2

PDB Entry: 4lt6, 2.79 Å

PDB Description: Crystal Structure of human poly(A) polymerase gamma

PDB Compounds: (A:) Poly(A) polymerase gamma

SCOPe Domain Sequences for d4lt6a2:

Sequence; same for both SEQRES and ATOM records:

>d4lt6a2 a.160.1.0 (A:214-363) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pnketfrltlravklwakrrgiysnmlgflggvswamlvartcqlypnaaastlvhkffl
vfskwewpnpvllkqpeesnlnlpvwdprvnpsdryhlmpiitpaypqqnstynvststr
tvmveefkqglavtdeilqgksdwskllep

Timeline for d4lt6a2:

• d4lt6a2 first appeared in SCOPe 2.04
  
• d4lt6a2 appears in SCOPe 2.07