Lineage for d4lora1 (4lor A:2-116)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2777703Fold b.23: CUB-like [49853] (3 superfamilies)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2777704Superfamily b.23.1: Spermadhesin, CUB domain [49854] (2 families) (S)
    automatically mapped to Pfam PF00431
  5. 2777705Family b.23.1.1: Spermadhesin, CUB domain [49855] (6 proteins)
  6. 2777709Protein Complement C1S component [89258] (1 species)
  7. 2777710Species Human (Homo sapiens) [TaxId:9606] [89259] (3 PDB entries)
  8. 2777713Domain d4lora1: 4lor A:2-116 [253682]
    Other proteins in same PDB: d4lora2
    automated match to d1nt0a1
    complexed with ca, na, nag

Details for d4lora1

PDB Entry: 4lor (more details), 2.5 Å

PDB Description: c1s cub1-egf-cub2 in complex with a collagen-like peptide from c1q
PDB Compounds: (A:) Complement C1s subcomponent heavy chain

SCOPe Domain Sequences for d4lora1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lora1 b.23.1.1 (A:2-116) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]}
ptmygeilspnypqaypsevekswdievpegygihlyfthldielsencaydsvqiisgd
teegrlcgqrssnnphspiveefqvpynklqvifksdfsneerftgfaayyvatd

SCOPe Domain Coordinates for d4lora1:

Click to download the PDB-style file with coordinates for d4lora1.
(The format of our PDB-style files is described here.)

Timeline for d4lora1: