![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.23: CUB-like [49853] (3 superfamilies) sandwich, 10 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.23.1: Spermadhesin, CUB domain [49854] (2 families) ![]() automatically mapped to Pfam PF00431 |
![]() | Family b.23.1.1: Spermadhesin, CUB domain [49855] (6 proteins) |
![]() | Protein Complement C1S component [89258] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [89259] (3 PDB entries) |
![]() | Domain d4lora1: 4lor A:2-116 [253682] Other proteins in same PDB: d4lora2 automated match to d1nt0a1 complexed with ca, na, nag |
PDB Entry: 4lor (more details), 2.5 Å
SCOPe Domain Sequences for d4lora1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lora1 b.23.1.1 (A:2-116) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} ptmygeilspnypqaypsevekswdievpegygihlyfthldielsencaydsvqiisgd teegrlcgqrssnnphspiveefqvpynklqvifksdfsneerftgfaayyvatd
Timeline for d4lora1: