Lineage for d1dgtb2 (1dgt B:2315-2400)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 58940Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 59438Superfamily b.40.4: Nucleic acid-binding proteins [50249] (8 families) (S)
  5. 59637Family b.40.4.6: DNA ligase/mRNA capping enzyme, domain 2 [50307] (3 proteins)
  6. 59643Protein NAD+-dependent DNA ligase [50313] (1 species)
  7. 59644Species Thermus filiformis [TaxId:276] [50314] (2 PDB entries)
  8. 59648Domain d1dgtb2: 1dgt B:2315-2400 [25368]
    Other proteins in same PDB: d1dgta1, d1dgta3, d1dgtb1, d1dgtb3, d1dgtb4

Details for d1dgtb2

PDB Entry: 1dgt (more details), 2.9 Å

PDB Description: crystal structure of nad+-dependent dna ligase

SCOP Domain Sequences for d1dgtb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dgtb2 b.40.4.6 (B:2315-2400) NAD+-dependent DNA ligase {Thermus filiformis}
aeeketrlldvvfqvgrtgrvtpvgvlepvfiegsevsrvtlhnesyieeldirigdwvl
vhkaggvipevlrvlkerrtgkerpi

SCOP Domain Coordinates for d1dgtb2:

Click to download the PDB-style file with coordinates for d1dgtb2.
(The format of our PDB-style files is described here.)

Timeline for d1dgtb2: