SCOPe 2.08: Domain d4loia1: 4loi A:155-338

Lineage for d4loia1 (4loi A:155-338)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.387: STING C-terminal-like [254119] (1 superfamily)
   5 helices and 5 strands in one mixed beta-sheet, one long bent helix

4. Superfamily d.387.1: STING, TM173 CTD-like [254144] (2 families)
   Pfam PF15009, PubMed 22579474

5. Family d.387.1.1: Tyrosinase cofactor MelC1 [254191] (2 proteins)

6. Protein Tyrosinase cofactor MelC1 [254420] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [254863] (48 PDB entries)

8. Domain d4loia1: 4loi A:155-338 [253674]
   Other proteins in same PDB: d4loia2, d4loib2
   automated match to d4ef5a_
   complexed with 1yc, po4

Details for d4loia1

PDB Entry: 4loi, 1.89 Å

PDB Description: Crystal structure of hSTING(H232) in complex with c[G(2',5')pA(2',5')p]

PDB Compounds: (A:) Stimulator of interferon genes protein

SCOPe Domain Sequences for d4loia1:

Sequence, based on SEQRES records:

>d4loia1 d.387.1.1 (A:155-338) Tyrosinase cofactor MelC1 {Human (Homo sapiens) [TaxId: 9606]}
vahglawsyyigylrlilpelqarirtynqhynnllrgavsqrlyillpldcgvpdnlsm
adpnirfldklpqqtgdhagikdrvysnsiyellengqragtcvleyatplqtlfamsqy
sqagfsredrleqaklfcrtlediladapesqnncrliayqepaddssfslsqevlrhlr
qeek

Sequence, based on observed residues (ATOM records):

>d4loia1 d.387.1.1 (A:155-338) Tyrosinase cofactor MelC1 {Human (Homo sapiens) [TaxId: 9606]}
vahglawsyyigylrlilpelqarirtynqhrgavsqrlyillpldcgvpdnlsmadpni
rfldklpqqtgdhagikdrvysnsiyellengqragtcvleyatplqtlfamsqysqagf
sredrleqaklfcrtlediladapqnncrliayqepaddssfslsqevlrhlrqeek

Timeline for d4loia1:

• d4loia1 first appeared in SCOPe 2.04, called d4loia_
  
• d4loia1 appears in SCOPe 2.07