SCOPe 2.06: Domain d4lo3b1: 4lo3 B:10-151

Lineage for d4lo3b1 (4lo3 B:10-151)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.2: Ricin B-like lectins [50370] (4 families)

5. Family b.42.2.0: automated matches [227190] (1 protein)
   not a true family

6. Protein automated matches [226913] (9 species)
   not a true protein

7. Species Clostridium botulinum [TaxId:1491] [254975] (8 PDB entries)

8. Domain d4lo3b1: 4lo3 B:10-151 [253670]
   Other proteins in same PDB: d4lo3a3, d4lo3b3
   automated match to d2e4ma1

Details for d4lo3b1

PDB Entry: 4lo3, 2.25 Å

PDB Description: ha17-ha33-lacnac

PDB Compounds: (B:) ha-33

SCOPe Domain Sequences for d4lo3b1:

Sequence; same for both SEQRES and ATOM records:

>d4lo3b1 b.42.2.0 (B:10-151) automated matches {Clostridium botulinum [TaxId: 1491]}
slndkivtisckadtnlffyqvagnvslfqqtrnylerwrliydsnkaaykiksmdihnt
nlvltwnapthnistqqdsnadnqywlllkdignnsfiiasyknpnlvlyadtvarnlkl
stlnnsnyikfiiedyiisdln

Timeline for d4lo3b1:

• d4lo3b1 first appeared in SCOPe 2.04
  
• d4lo3b1 appears in SCOPe 2.05
  
• d4lo3b1 appears in SCOPe 2.07
  
• d4lo3b1 appears in the current release, SCOPe 2.08